Cart summary

You have no items in your shopping cart.

Hantavirus Protein

SKU: orb81638

Description

The Hantavirus nucleocapsid (N) fusion protein protein is expressed in E.coli and fused to GST-tag having Mw of 37 kDa. Hantavirus nucleocapsid (N) is conserved among different strains, and is used to test the specific IgM and IgG to Hantavirus.

Images & Validation

Application Notes
Viral Antigens- Hantaan Virus

Key Properties

SourceE.Coli
Protein SequenceGSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD
PurificationPurified by proprietary chromatographic technique.
PurityHTNV protein is >95% pure as determined by 12% PAGE (coomassie staining).

Storage & Handling

StorageStability: Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles
Form/AppearanceSterile filtered colorless solution.
Buffer/PreservativesHTNV is formulated in 1xPBS pH-7.4 and 0.05% Sodium azide.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HTNV, Hantaan Virus, Hantanvirus.

Similar Products

  • Hantavirus GST [orb533530]

    > 95% (SDS-PAGE, 12%, coomassie staining)

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Hantavirus Protein (orb81638)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 380.00
0.5 mg
$ 1,010.00
1 mg
$ 1,890.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry