You have no items in your shopping cart.
Hantavirus Protein
SKU: orb81638
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Protein Sequence | GSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD |
| Purification | Purified by proprietary chromatographic technique. |
| Purity | HTNV protein is >95% pure as determined by 12% PAGE (coomassie staining). |
Storage & Handling
−| Storage | Stability: Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles |
|---|---|
| Form/Appearance | Sterile filtered colorless solution. |
| Buffer/Preservatives | HTNV is formulated in 1xPBS pH-7.4 and 0.05% Sodium azide. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−HTNV, Hantaan Virus, Hantanvirus.
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Hantavirus Protein (orb81638)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review