You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580290 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HADHB |
Target | HADHB |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human HADHB |
Protein Sequence | Synthetic peptide located within the following region: LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE |
UniProt ID | P55084 |
MW | 47kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ECHB, MTPB, MSTP029, TP-BETA |
Research Area | Cell Biology, Immunology & Inflammation, Signal Tr Read more... |
Note | For research use only |
NCBI | NP_000174 |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.
WB Suggested Anti-HADHB Antibody Titration: 0.25 ug/ml, Positive Control: HepG2 cell lysate. HADHB is supported by BioGPS gene expression data to be expressed in HepG2.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |