HADH Rabbit Polyclonal Antibody

• Catalog Number: orb582469
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HADH
• Target: HADH
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HADH
• Protein Sequence: Synthetic peptide located within the following region: YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG
• UniProt ID: Q16836
• MW: 33kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HAD, HCDH, HHF4, HADH1, SCHAD, HADHSC, MSCHAD
• Note: For research use only
• NCBI: NP_005318

HADH antibody - C-terminal region (orb582469), Catalog Number: orb582469, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in mitochondria of hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-HADH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.