Guinea pig TGF alpha protein

• Catalog Number: orb1215825
• Category: Proteins
• Description: The Guinea Pig TGF-alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TGF-alpha applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig TGF-alpha yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TGF-alpha Specifications: (Molecular Weight: 5.6 kDa) (Amino Acid Sequence: VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLL) (Gene ID: 102005158).
• Target: TGF alpha
• Form/Appearance: Lyophilized
• Purity: 98%
• Protein Sequence: VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
• Protein Length: 50
• MW: 5.6 kDa
• Source: Yeast
• Biological Origin: Guinea Pig
• Storage: -20°C
• Note: For research use only