Guinea pig CXCL1 protein

• Catalog Number: orb1216259
• Category: Proteins
• Description: The Guinea Pig CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. The Guinea Pig CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDEAPMVQKVLQRMLKGSKAT (72)) (Gene ID: 100135510).
• Target: CXCL1
• Form/Appearance: Lyophilized
• Purity: 98%
• Protein Sequence: APAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDEAPMVQKVLQRMLKGSKAT (72)
• Protein Length: 72
• MW: 7.8 kDa
• Source: Yeast
• Biological Origin: Guinea Pig
• Storage: -20°C
• Alternative names: GRO alpha
• Note: For research use only