GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

SKU: orb1981595

Description

This product is a synthetic derivative of the Exendin-4 peptide, with the sequence GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS. It is a research tool used in vitro and in vivo to study GLP-1 receptor signaling, metabolic pathways, and potential therapeutic applications for diabetes and obesity.

Research Area

Pharmacology & Drug Discovery

Images & Validation

−

Key Properties

−

Target	Glucagon Receptor
Molecular Weight	3850.31

Storage & Handling

−

Storage	-20°C
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Glucagon Receptor

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols