You have no items in your shopping cart.
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
SKU: orb1981595
Description
Research Area
Pharmacology & Drug Discovery
Images & Validation
−
Key Properties
−| Target | Glucagon Receptor |
|---|---|
| Molecular Weight | 3850.31 |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Glucagon Receptor
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (orb1981595)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review