GSTA2 Rabbit Polyclonal Antibody

• Catalog Number: orb588957
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GSTA2
• Target: GSTA2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSTA2
• Protein Sequence: Synthetic peptide located within the following region: KLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQV
• UniProt ID: P09210
• MW: 26 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GST2, GTA2, GTH2, GSTA2-2
• Note: For research use only
• NCBI: NP_000837.3

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1.0 ug/ml.