GRB2 Rabbit Polyclonal Antibody

• Catalog Number: orb584010
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRB2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24kDa
• Target: GRB2
• UniProt ID: P62993
• Protein Sequence: Synthetic peptide located within the following region: AKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIE
• NCBI: NP_002077
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ASH, Grb3-3, MST084, NCKAP2, MSTP084, EGFRBP-GRB2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

GRB2 antibody - N-terminal region (orb584010) validated by WB using 1. and 2. Human Cystic Fibrosis Bronchial Epithelial Cells (35 ug) Primary dilution: 1:500, Secondary Anitbody: goat anti-rabbit-HRPSecondary dilution: 1:5000.

GRB2 antibody - N-terminal region (orb584010) validated by WB using 721_B cell Lysate at 1 ug/ml. GRB2 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Rabbit Anti-GRB2 Antibody, Catalog Number: orb584010, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.