You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330634 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GPSM2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, IHC-P, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GPSM2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 76kDa |
Target | GPSM2 |
UniProt ID | P81274 |
Protein Sequence | Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA |
NCBI | NP_037428 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti LGN antibody, anti Pins antibody, anti PINS a Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human placenta tissue using GPSM2 antibody
Immunohistochemical staining of human Liver tissue using GPSM2 antibody
Western blot analysis of human Fetal Liver tissue using GPSM2 antibody
Immunohistochemical staining of human Liver tissue using GPSM2 antibody
Filter by Rating