GPSM2 Rabbit Polyclonal Antibody

• Catalog Number: orb330634
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPSM2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPSM2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 76kDa
• Target: GPSM2
• UniProt ID: P81274
• Protein Sequence: Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA
• NCBI: NP_037428
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti LGN antibody, anti Pins antibody, anti PINS a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-GPSM2 antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

GPSM2 antibody - N-terminal region (orb330634) validated by WB using Fetal Liver Lysate at 1 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): Human Ovary (OV), Antibody concentration: 1 ug/ml.

IAnti-GPSM2 antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Rabbit Anti-GPSM2 Antibody, Paraffin Embedded Tissue: Human Liver, Antibody Concentration: 5 ug/ml.