You have no items in your shopping cart.
GPS2 Rabbit Polyclonal Antibody
SKU: orb586016
Description
Research Area
Cancer, Epigenetics, Infectious Diseases
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of mouse GPS2 |
| Target | GPS2 |
| Protein Sequence | Synthetic peptide located within the following region: LKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHN |
| Molecular Weight | 37kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−AMF-1
Similar Products
−GPS2 Rabbit Polyclonal Antibody [orb157376]
WB
Bovine, Canine, Porcine, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Mouse Liver lysates, Antibody dilution: 1.0 ug/ml.
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_004480.1 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
GPS2 Rabbit Polyclonal Antibody (orb586016)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





