You have no items in your shopping cart.
Cart summary
GPR85 Peptide - N-terminal region
Catalog Number: orb2006816
| Catalog Number | orb2006816 |
|---|---|
| Category | Proteins |
| Description | GPR85 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | YFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCF |
| UniProt ID | P60893 |
| MW | 42kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | FLJ50993, FLJ51159, FLJ99433, SREB, SREB2 |
| Note | For research use only |
| NCBI | NP_061843 |
