Cart summary

You have no items in your shopping cart.

GPR135 Rabbit Polyclonal Antibody (FITC)

GPR135 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2089680

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2089680
CategoryAntibodies
DescriptionGPR135 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen for Anti-GPR135 antibody is: synthetic peptide directed towards the C-terminal region of Human GP135
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW54 kDa
UniProt IDQ8IZ08
Protein SequenceSynthetic peptide located within the following region: SVVAVWLTWANGAINPVIYAIRNPNISMLLGRNREEGYRTRNVDAFLPSQ
NCBINP_072093.2
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesHUMNPIIY20
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.