Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GP2 Rabbit Polyclonal Antibody

SKU: orb579212

Description

GP2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GP2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human GP2. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Mouse, Porcine, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Equine, Mouse, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GP2
TargetGP2
Protein SequenceSynthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
Molecular Weight59 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ZAP75

Similar Products

  • GP2 Antibody (N-term) [orb140051]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Lassa virus/LASV GPC Rabbit Polyclonal Antibody [orb2954251]

    ELISA,  IHC,  WB

    Virus

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • Lassa virus/LASV GPC Rabbit Polyclonal Antibody [orb2954250]

    ELISA,  IHC,  WB

    Virus

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • GP2 Rabbit Polyclonal Antibody [orb623866]

    ELISA,  FC,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • LCMV Glycoprotein GP2 Rabbit Polyclonal Antibody [orb2950264]

    ELISA,  IHC,  WB

    Virus

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GP2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment. The canonical isoform of 59 kDa is present as well as a second isoform around 43 kDa.

GP2 Rabbit Polyclonal Antibody

Anti-GP2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

GP2 Rabbit Polyclonal Antibody

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.

GP2 Rabbit Polyclonal Antibody

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GP2 is expressed in HepG2.

GP2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

GP2 Rabbit Polyclonal Antibody

Positive control (+): Human Fetal Heart (HE), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.

GP2 Rabbit Polyclonal Antibody

WB Suggested Anti-GP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

GP2 Rabbit Polyclonal Antibody (orb579212)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry