GOAT ANTI HUMAN INTERLEUKIN-21 (N-TERMINAL)

• Catalog Number: orb431063
• Category: Antibodies
• Description: Goat polyclonal antibody to IL-21
• Target: IL-21
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: Polyclonal IgG
• Conjugation: Unconjugated
• Reactivity: Human
• Form/Appearance: Purified IgG - liquid
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Purified IgG - liquid
• Purity: Purified
• Immunogen: Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminal region of human IL-21.
• UniProt ID: Q9HBE4
• Tested applications: ELISA, ICC, IF, IHC-P
• Application notes: (N-TERMINAL)
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Research Area: Epigenetics
• Note: For research use only