You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb1536946 |
|---|---|
| Category | Antibodies |
| Description | GNT-V/MGAT5 Antibody |
| Target | GNT-V / MGAT5 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Isotype | IgG |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Concentration | 0.57 mg/ml |
| Buffer/Preservatives | PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol |
| Purification | Affinity purified |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 627-741 of human MGAT5 (NP_002401.1). HGQVMWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL |
| Tested applications | IHC-P, WB |
| Dilution range | IHC-P (1:200), WB (1:500 - 1:2000) |
| Application notes | Further information: The predicted MW is 84kDa, while the observed MW by Western blot was 115kDa. |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MGAT5, GNT-VA, GNT-V, GGNT5, GlcNAc-T V |
| Note | For research use only |

Western blot analysis of extracts of various cell lines, using MGAT5 antibody at 1:1000 dilution.
WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review