You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2694368 |
---|---|
Category | Proteins |
Description | GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) is a biotinylated GLP-1 fragment, corresponding to the 7-36 sequence of GLP-1. |
CAS Number | 1802086-70-9 |
Purity | ≥95% |
MW | 3652.18 |
Formula | C165H252N44O48S |
Target | GLP Receptor |
Protein Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-{Lys(Biotinyl)}-NH2 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |