GLP-1 (1-37) (human, rat)

• Catalog Number: orb1147103
• Category: Proteins
• Description: Pancreatic hormone from posttranslational proglucagon proteolysis; Peptides.
• CAS Number: 87805-34-3
• Form/Appearance: Freeze dried solid
• Purity: > 95% by HPLC
• MW: 4169.5 Da
• Formula: C₁₈₆H₂₇₅N₅₁O₅₉
• Solubility (25°C): Soluble in dilute acid
• Protein Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
• Storage: Store dry, frozen and desiccated
• Alternative names: GLP-1 (1-37)
• Note: For research use only
• Expiration Date: 12 months from date of receipt.