You have no items in your shopping cart.
Cart summary
GJB2 Peptide - N-terminal region
Catalog Number: orb1997917
| Catalog Number | orb1997917 |
|---|---|
| Category | Proteins |
| Description | GJB2 Peptide - N-terminal region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| MW | 24 kDa |
| UniProt ID | Q00977 |
| Protein Sequence | Synthetic peptide located within the following region: DWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADF |
| NCBI | NP_032151.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | Cx26, Cnx26, Gjb-2, AI325222 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
