You have no items in your shopping cart.
GHRF, mouse
SKU: orb2694895
Description
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| Molecular Weight | 5032.85 |
| Protein Sequence | HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−- Item 1 of 1
Mouse Growth Hormone Releasing Hormone (GHRH) ELISA Kit [orb1949185]
Mouse
15.63-1000pg/mL
9.38 pg/mL
48 T, 96 T - Item 1 of 1
Mouse Growth Hormone Releasing Hormone (GHRH) ELISA Kit [orb776426]
Mouse
15.63-1000 pg/mL
4.44 pg/mL
48 T, 96 T - Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
others
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
GHRF, mouse (orb2694895)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review