GHRF (1-44), human

• Catalog Number: orb2694934
• Category: Proteins
• Description: Growth Hormone Releasing FactorGHRF (1-44), human Overview Properties Growth hormone-releasing factor (GHRF) is a hypothalamic peptide which positively regulates the synthesis and secretion of growth hormone in the anterior pituitary. The amino-acid sequence of a 43-residue GHRF peptide isolated from rat hypothalamus was recently determined.
• Target: GnRH Receptor
• Purity: ≥95%
• Protein Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
• MW: 5039.7
• CAS Number: 83930-13-6
• Formula: C₂₁₅H₃₅₈N₇₂O₆₆S
• Note: For research use only