Cart summary

You have no items in your shopping cart.

GGN Rabbit Polyclonal Antibody (HRP)

GGN Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2108303

Select Product Size
SizePriceQuantity
100 μl$ 680.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Catalog Numberorb2108303
CategoryAntibodies
DescriptionGGN Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GGN
Protein SequenceSynthetic peptide located within the following region: GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT
UniProt IDQ86UU5
MW67kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesFLJ35713, MGC33369
NoteFor research use only
NCBINP_689870
Expiration Date12 months from date of receipt.
  • GGN Rabbit Polyclonal Antibody (HRP) [orb478552]

    IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Mouse, Porcine, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl