You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330383 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GGCX |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GGCX |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 87kDa |
Target | GGCX |
UniProt ID | P38435 |
Protein Sequence | Synthetic peptide located within the following region: FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE |
NCBI | NP_000812 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ26629 antibody, anti VKCFD1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human Liver tissue using GGCX antibody
Western blot analysis of human Jurkat tissue using GGCX antibody
Western blot analysis of MCF7 cell lysate tissue using GGCX antibody
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating