GCLM Rabbit Polyclonal Antibody

• Catalog Number: orb582412
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GCLM
• Target: GCLM
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GCLM
• Protein Sequence: Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ
• UniProt ID: P48507
• MW: 31kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GLCLR
• Note: For research use only
• NCBI: NP_002052

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Anti-GCLM antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. GCLM Antibody orb582412 concentration 5 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.

Lanes: 1: 40 ug mouse heart lysate, 2: 40 ug mouse skeletal muscle lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GCLM.

WB Suggested Anti-GCLM Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.