GCKR Rabbit Polyclonal Antibody

• Catalog Number: orb331240
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GCKR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 68kDa
• Target: GCKR
• UniProt ID: Q14397
• Protein Sequence: Synthetic peptide located within the following region: PIALLSLLFRCSITEAQAHLAAAPSVCEAVRSALAGPGQKRTADPLEILE
• NCBI: NP_001477
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti GKRP antibody, anti FGQTL5 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Antibody dilution: 1.0 ug/ml, Sample Type: 721_B cell lysate. GCKR is supported by BioGPS gene expression data to be expressed in 721_B.