You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2693917 |
---|---|
Category | Proteins |
Description | GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors. |
Target | others |
Purity | ≥95% |
Protein Sequence | APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 |
MW | 2805.4 |
CAS Number | 74815-57-9 |
Formula | C126H198N38O31S2 |
Note | For research use only |