GAMT Rabbit Polyclonal Antibody

• Catalog Number: orb578575
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GAMT
• Target: GAMT
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAMT
• Protein Sequence: Synthetic peptide located within the following region: PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI
• UniProt ID: A8K0A0
• MW: 29kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PIG2, CCDS2, TP53I2, HEL-S-20
• Note: For research use only
• NCBI: NP_620279

Rabbit Anti-GAMT Antibody, Catalog Number: orb578575, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GAMT Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.

WB Suggested Anti-GAMT antibody Titration: 1 ug/ml, Sample Type: Human liver.