GALP Rabbit Polyclonal Antibody

• Catalog Number: orb585570
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GALP
• Target: GALP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Predicted Reactivity: Human, Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP
• Protein Sequence: Synthetic peptide located within the following region: VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP
• UniProt ID: Q9UBC7
• MW: 13 kDa
• Tested applications: IHC
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_149097

Rabbit Anti-GALP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.