Gallus CCL20 protein

SKU: orb1216356

Description

The Chicken CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL20 Specifications: (Molecular Weight: 8.3 kDa) (Amino Acid Sequence: QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM) (Gene ID: 395082).

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Chicken
Target	CCL20
Molecular Weight	8.3 kDa
Protein Length	72.0
Protein Sequence	QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM
Purity	98%

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

LARC

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

CCL20

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols