Gallus CCL20 protein

• Catalog Number: orb1216356
• Category: Proteins
• Description: The Chicken CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL20 Specifications: (Molecular Weight: 8.3 kDa) (Amino Acid Sequence: QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM) (Gene ID: 395082).
• Target: CCL20
• Form/Appearance: Lyophilized
• Purity: 98%
• Protein Sequence: QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM
• Protein Length: 72
• MW: 8.3 kDa
• Source: Yeast
• Biological Origin: Chicken
• Storage: -20°C
• Alternative names: LARC
• Note: For research use only