You have no items in your shopping cart.
Cart summary
Gallus, Aves IGF-2 protein
Catalog Number: orb1216310
| Catalog Number | orb1216310 |
|---|---|
| Category | Proteins |
| Description | The Multi-species IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Multi-species IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67)) (Gene ID: 100303676). |
| Target | IGF-2 |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67) |
| Protein Length | 67 |
| MW | 7.5 kDa |
| Source | Yeast |
| Biological Origin | Chicken/Turkey |
| Storage | -20°C |
| Alternative names | Somatomedin A |
| Note | For research use only |
