Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Gallus, Aves IGF-2 protein

SKU: orb1216310

Description

The Multi-species IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Multi-species IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67)) (Gene ID: 100303676).

Research Area

Metabolism Research

Images & Validation

Key Properties

SourceYeast
Biological OriginChicken/Turkey
TargetIGF-2
Protein Length67.0
MW7.5 kDa
Purity98%
Protein SequenceYGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Somatomedin A
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Gallus, Aves IGF-2 protein (orb1216310)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
100 μg
$ 1,340.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry