You have no items in your shopping cart.
Galanin (1-29)(rat, mouse)
SKU: orb2694118
Description
Images & Validation
−
Key Properties
−| Target | Neuropeptide Y Receptor |
|---|---|
| Molecular Weight | 3164.48 |
| Protein Sequence | GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−Galanin (1-29) (rat, mouse) [orb1140530]
> 95% by hplc
3164.48 Da
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Neuropeptide Y Receptor
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Galanin (1-29)(rat, mouse) (orb2694118)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days