You have no items in your shopping cart.
Cart summary
GADD45GIP1 Peptide - N-terminal region
Catalog Number: orb2000972
| Catalog Number | orb2000972 |
|---|---|
| Category | Proteins |
| Description | GADD45GIP1 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: LLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQ |
| UniProt ID | Q8TAE8 |
| MW | 24 kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with GADD45GIP1 Rabbit Polyclonal Antibody (orb588876). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | PRG6, CRIF1, PLINP, CKBBP2, Plinp1, MRP-L59, PLINP Read more... |
| Note | For research use only |
| NCBI | NP_443082.2 |
