Fzr1 Peptide - N-terminal region

• Catalog Number: orb2010613
• Category: Proteins
• Description: Fzr1 Peptide - N-terminal region
• Predicted Reactivity: Mouse
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: RQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVN
• UniProt ID: Q9R1K5
• MW: 55kDa
• Tested applications: WB
• Application notes: This is a synthetic peptide designed for use in combination with Fzr1 Rabbit Polyclonal Antibody (orb581329). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: AW108046, Cdh1, FZR, FZR2, Fyr, HCDH, HCDH1
• Note: For research use only
• NCBI: NP_062731
• Expiration Date: 6 months from date of receipt.