Cart summary

You have no items in your shopping cart.

FUBP3 Peptide - N-terminal region

FUBP3 Peptide - N-terminal region

Catalog Number: orb1999849

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1999849
CategoryProteins
DescriptionFUBP3 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW62 kDa
UniProt IDQ96I24
Protein SequenceSynthetic peptide located within the following region: GEGLVGDGPVDMRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNGLTTV
NCBINP_003925.1
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesFBP3
Read more...
NoteFor research use only
Expiration Date6 months from date of receipt.