Cart summary

You have no items in your shopping cart.

FOLR1 Peptide - middle region

FOLR1 Peptide - middle region

Catalog Number: orb1997581

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1997581
CategoryProteins
DescriptionFOLR1 Peptide - middle region
Predicted ReactivityMouse
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: LYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERIL
UniProt IDP35846
MW28 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesFBP1, Folbp1, Folbp-1
NoteFor research use only
NCBINP_001239481.1