You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1997581 |
---|---|
Category | Proteins |
Description | FOLR1 Peptide - middle region |
Predicted Reactivity | Mouse |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | Synthetic peptide located within the following region: LYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERIL |
UniProt ID | P35846 |
MW | 28 kDa |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | FBP1, Folbp1, Folbp-1 |
Note | For research use only |
NCBI | NP_001239481.1 |