Fndc9 antibody

• Catalog Number: orb325143
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Fndc9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26kDa
• Target: Fndc9
• UniProt ID: Q8BJN4
• Protein Sequence: Synthetic peptide located within the following region: TGAIISWSPSEPCLEDYYHIMYRPNWNSIFSGYLRYNFHHEEKVPRTITS
• NCBI: NP_796049
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC129498 antibody, anti MGC129499 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of mouse Thymus tissue using Fndc9 antibody