Cart summary

You have no items in your shopping cart.

FLJ10490 Rabbit Polyclonal Antibody (FITC)

FLJ10490 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2102184

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2102184
CategoryAntibodies
DescriptionFLJ10490 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FLJ10490
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW14kDa
UniProt IDQ9NVV2
Protein SequenceSynthetic peptide located within the following region: VVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVG
NCBINP_060581
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesFLJ10490
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.