You have no items in your shopping cart.
Cart summary
Item 1 of 1
| Catalog Number | orb9570 |
|---|---|
| Category | Proteins |
| Description | Recombinant of fish Vertebrate ancient opsin protein |
| Tag | N-terminal 6xHis-B2M-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 22.5 kDa |
| UniProt ID | O13018 |
| Protein Sequence | MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Salmo salar (Atlantic salmon) |
| Expression Region | 1-75aa |
| Endotoxins | Not test. |
| RRID | AB_10924788 |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Vertebrate ancient opsin Read more... |
| Note | For research use only |
| Application notes | Tag info: N-terminal 6xHis-B2M-taggedExpression Region: 1-75aaSequence Info: Partial Glycerol content: 0.5 |
| Expiration Date | 6 months from date of receipt. |
Choi, Ji Yong et al. Effects of recombinant vertebrate ancient long opsin on reproduction in goldfish, Carassius auratus: profiling green-wavelength light Fish Physiol Biochem, 44, 1027-1036 (2018)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Fish Salmo salar Vertebrate ancient opsin protein [orb54688]
Greater than 90% as determined by SDS-PAGE.
24.5 kDa
in vitro E.coli expression system
100 μg, 20 μg
