Cart summary

You have no items in your shopping cart.

Fish Leptin Protein

SKU: orb426836

Description

Recombinant of fish Leptin protein

Images & Validation

Application Notes
Protein content: Protein quantitation was carried out by UV spectroscopy at 280 nm using the absorbency value of 1.28 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics)

Key Properties

SourceEscherichia Coli
Biological ActivityBiological active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. The affinity of human leptin receptors is considerably lower campared to mammalian leptins.
Protein SequenceALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVE GSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQE QQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC
PurityGreater than 99.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

StorageStability: Lyophilized Pufferfish Leptin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leptin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesThe Pufferfish Leptin was lyophilized from a concentrated (0.85mg/ml) solution with 0.003mM NaHCO3.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

OB Protein, Obesity Protein, OBS, Obesity factor.

Similar Products

  • LEP-B Antibody [orb860354]

    ELISA,  WB

    Rabbit

    Polyclonal

    Unconjugated

    2 mg
  • Fish Leptin-B Protein [orb611027]

    Greater than 95.0% as determined by:(a) Gel filtration analysis.(b) Analysis by SDS-PAGE.

    Escherichia Coli

    1 mg, 100 μg, 20 μg
  • Fish Leptin-A Protein [orb611026]

    Greater than 95.0% as determined by:(a) Gel filtration analysis.(b) Analysis by SDS-PAGE.

    Escherichia Coli

    1 mg, 100 μg, 20 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Fish Leptin Protein (orb426836)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 300.00
100 μg
$ 550.00
1 mg
$ 2,460.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry