Fish Leptin Protein

SKU: orb426836

Description

Recombinant of fish Leptin protein

Images & Validation

• Application Notes:
  Protein content: Protein quantitation was carried out by UV spectroscopy at 280 nm using the absorbency value of 1.28 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics)

Key Properties

• Source: Escherichia Coli
• Biological Activity: Biological active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. The affinity of human leptin receptors is considerably lower campared to mammalian leptins.
• Protein Sequence: ALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVE GSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQE QQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC
• Purity: Greater than 99.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

• Storage: Stability: Lyophilized Pufferfish Leptin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leptin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: The Pufferfish Leptin was lyophilized from a concentrated (0.85mg/ml) solution with 0.003mM NaHCO3.
• Disclaimer: For research use only

Alternative Names

OB Protein, Obesity Protein, OBS, Obesity factor.