You have no items in your shopping cart.
Cart summary
Fibronectin-Binding Protein
Catalog Number: orb2694661
| Catalog Number | orb2694661 |
|---|---|
| Category | Proteins |
| Description | Fibronectin-binding proteins (FnBPs) are a class of conserved components that are ubiquitous on the surface of bacteria, and in many gram-positive bacteria, they can recognize matrix molecules that adhere to host cells and induce the production of inflammatory cytokines. |
| Purity | ≥95% |
| MW | 4309.66 |
| Formula | C190H283N49O66 |
| Target | others |
| Protein Sequence | FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 3
Bacterial fbpC protein [orb358762]
Greater than 90% as determined by SDS-PAGE.
36.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85A (fbpA), partial [orb2659857]
Greater than 90% as determined by SDS-PAGE.
34.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
- Item 1 of 1
Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB) [orb2658720]
Greater than 95% as determined by SDS-PAGE.
38.1 kDa
E.coli
1 mg, 20 μg, 100 μg - Item 1 of 1
Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB) [orb2658761]
Greater than 95% as determined by SDS-PAGE.
37.5 kDa
E.coli
20 μg, 100 μg, 1 mg
