You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2694661 |
---|---|
Category | Proteins |
Description | Fibronectin-binding proteins (FnBPs) are a class of conserved components that are ubiquitous on the surface of bacteria, and in many gram-positive bacteria, they can recognize matrix molecules that adhere to host cells and induce the production of inflammatory cytokines. |
Purity | ≥95% |
MW | 4309.66 |
Formula | C190H283N49O66 |
Target | others |
Protein Sequence | FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
36.1 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
34.1 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
38.1 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
37.5 kDa | |
E.coli |