You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2006866 |
---|---|
Category | Proteins |
Description | Fgf9 Peptide - N-terminal region |
Predicted Reactivity | Human, Mouse |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | AVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFIS |
UniProt ID | P54130 |
MW | 23kDa |
Tested applications | WB |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | Eks |
Note | For research use only |
NCBI | NP_038546 |