You have no items in your shopping cart.
Cart summary
Fgf9 Peptide - N-terminal region
Catalog Number: orb2006866
| Catalog Number | orb2006866 |
|---|---|
| Category | Proteins |
| Description | Fgf9 Peptide - N-terminal region |
| Predicted Reactivity | Human, Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | AVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFIS |
| UniProt ID | P54130 |
| MW | 23kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | Eks |
| Note | For research use only |
| NCBI | NP_038546 |
