You have no items in your shopping cart.
Cart summary
FGF5 Peptide - N-terminal region
Catalog Number: orb1999217
| Catalog Number | orb1999217 |
|---|---|
| Category | Proteins |
| Description | FGF5 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 30 kDa |
| UniProt ID | P12034 |
| Protein Sequence | Synthetic peptide located within the following region: LLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSS |
| NCBI | NP_004455.2 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | HBGF-5, TCMGLY, Smag-82 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
