You have no items in your shopping cart.
Cart summary
Feline IL-1 beta protein
Catalog Number: orb1216337
| Catalog Number | orb1216337 |
|---|---|
| Category | Proteins |
| Description | The Feline IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: AAIQSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTSQAEEMPVFLGNTKGGQDITDFIMESAS) (Gene ID: 768274). |
| Target | IL-1 beta |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | AAIQSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTSQAEEMPVFLGNTKGGQDITDFIMESAS |
| Protein Length | 152 |
| MW | 17.4 kDa |
| Source | Yeast |
| Biological Origin | Feline |
| Storage | -20°C |
| Alternative names | IL-1F2 |
| Note | For research use only |
- Item 1 of 1
Porcine IL-1 beta protein [orb107741]
HPLC, SDS-PAGE
Unconjugated
> 95 % by SDS-PAGE and HPLC analyses
17.6 kDa
10 μg, 100 μg, 500 μg Feline IL1B Protein, His Tag [orb2698715]
> 95%, determined by SDS-PAGE
This protein contains the feline IL1B (NP_001070882.1) (Ala116-Ser267) was expressed with an initial Met.
10 μg, 5 μg
