Feline IL-1 alpha protein

SKU: orb1216293

Description

The Feline IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 alpha Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence: SVAPNFYSSEKYNYQKIIKSQFILNDNLSQSVIRKAGGKYLAAAALQNLDDAVKFDMGAYTSKEDSKLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKNYFKSVAHPKLFIATQEEQLVHMARGLPSVTDFQILETQS (158)) (Gene ID: 493944).

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Feline
Target	IL-1 alpha
Molecular Weight	18.0 kDa
Protein Length	158.0
Protein Sequence	SVAPNFYSSEKYNYQKIIKSQFILNDNLSQSVIRKAGGKYLAAAALQNLDDAVKFDMGAYTSKEDSKLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKNYFKSVAHPKLFIATQEEQLVHMARGLPSVTDFQILETQS (158)
Purity	98%

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Disclaimer	For research use only

Alternative Names

−

IL-1F1

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

IL-1 alpha

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols