Cart summary

You have no items in your shopping cart.

FBXL4 Rabbit Polyclonal Antibody (HRP)

FBXL4 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2105966

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2105966
CategoryAntibodies
DescriptionFBXL4 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FBXL4
Protein SequenceSynthetic peptide located within the following region: VLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERPTKVNASQARQF
UniProt IDQ9UKA2
MW70kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesFBL4, FBL5, MTDPS13
NoteFor research use only
NCBINP_036292
  • FbxL4 Rabbit Polyclonal Antibody (HRP) [orb470818]

    IHC-Fr,  IHC-P

    Bovine, Gallus, Mouse, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl