FARS2 Rabbit Polyclonal Antibody

• Catalog Number: orb577727
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FARS2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FARS2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: FARS2
• UniProt ID: O95363
• Protein Sequence: Synthetic peptide located within the following region: VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ
• NCBI: NP_006558
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FARS1, PheRS, SPG77, COXPD14, HSPC320, mtPheRS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-FARS2 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-FARS2 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.