Cart summary

You have no items in your shopping cart.

FAM71A Rabbit Polyclonal Antibody (FITC)

FAM71A Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2108133

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2108133
CategoryAntibodies
DescriptionFAM71A Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Guinea pig, Human, Porcine, Rabbit
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FAM71A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW63kDa
UniProt IDQ8IYT1
Protein SequenceSynthetic peptide located within the following region: PGSSRHRDSHKGVSHTPISKESRTSHKSGRSLWTTSSGSSKGLGRVSSFL
NCBINP_705834
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesGARI-L4
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.