Cart summary

You have no items in your shopping cart.

FAM54A Rabbit Polyclonal Antibody (Biotin)

FAM54A Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2110144

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2110144
CategoryAntibodies
DescriptionFAM54A Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Human, Rabbit
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FAM54A
Protein SequenceSynthetic peptide located within the following region: NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ
UniProt IDQ6P444
MW43kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesDUFD1, FAM54A
NoteFor research use only
NCBINP_001092756