Cart summary

You have no items in your shopping cart.

FAM234A Rabbit Polyclonal Antibody (HRP)

FAM234A Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2112230

Select Product Size
SizePriceQuantity
100 μl$ 680.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Catalog Numberorb2112230
CategoryAntibodies
DescriptionFAM234A Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ITFG3
Protein SequenceSynthetic peptide located within the following region: RSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA
UniProt IDQ9H0X4
MW60kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesgs19, ITFG3, C16orf9
NoteFor research use only
NCBINP_114428
Expiration Date12 months from date of receipt.