Cart summary

You have no items in your shopping cart.

FAM153B Rabbit Polyclonal Antibody (FITC)

FAM153B Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2086422

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2086422
CategoryAntibodies
DescriptionFAM153B Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of human FAM153B
Protein SequenceSynthetic peptide located within the following region: DPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKK
UniProt IDP0C7A2
MW42kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
NoteFor research use only