FAIM2 Peptide - N-terminal region

• Catalog Number: orb1999177
• Category: Proteins
• Description: FAIM2 Peptide - N-terminal region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: Synthetic peptide located within the following region: GEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSS
• UniProt ID: Q9BWQ8
• MW: 35 kDa
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: LFG, LFG2, NGP35, NMP35, TMBIM2
• Note: For research use only
• NCBI: NP_036438.2
• Expiration Date: 6 months from date of receipt.